SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A024WYX5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A024WYX5
Domain Number 1 Region: 244-290
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000222
Family TSP-1 type 1 repeat 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A024WYX5
Sequence length 352
Comment (tr|A0A024WYX5|A0A024WYX5_PLAFC) Uncharacterized protein {ECO:0000313|EMBL:ETW58068.1} KW=Complete proteome OX=5835 OS=Plasmodium falciparum (isolate Camp / Malaysia). GN=PFMC_06035 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MIDVLLNKTNYLYFTFLLFLYISSNDLCSCNLKVRNNWEHFLQVYQNNGNFKMEILEPEC
TIQKNLPSEEEKEEFIDFDRKELLLHDFVVIKNSQFTDEKTLELYLSKEENNKSYLMLTF
YLGDLKLMIGHNSPYEISLILNVATVNKNMSNCKNNSYNIVLLKTTDVFNTSDLEILEGP
IQFSLGKSSGAFRINVTNFFLNNTWKAFTKDKISFLIKPEENCYTILENKINKPQLLIEK
KTTFYSEWGEWSNCSMDCDHPDNVQIRERECIHPSGDCFKGDLKESRPCIIPLPPCNELF
SHKDNSTFKILMIILPIVLVISIITILYHIFYKRKGAEKELYENVAGRYMYD
Download sequence
Identical sequences A0A024V4A9 A0A024WNZ1 A0A024WYX5 A0A0L1IDX2 Q8I5M8 W4IDQ1 W4J3L5 W7FV44 W7J9R7 W7K461
PFL0870w gi|124805940|ref|XP_001350582.1| gi|23496706|gb|AAN36262.1| XP_001350582.1.26446 5833.PFL0870w-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]