SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A024X2Y1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A024X2Y1
Domain Number 1 Region: 42-238
Classification Level Classification E-value
Superfamily vWA-like 7.47e-32
Family Integrin A (or I) domain 0.0069
Further Details:      
 
Domain Number 2 Region: 244-286
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000968
Family TSP-1 type 1 repeat 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A024X2Y1
Sequence length 559
Comment (tr|A0A024X2Y1|A0A024X2Y1_PLAFC) Uncharacterized protein {ECO:0000313|EMBL:ETW59405.1} KW=Complete proteome OX=5835 OS=Plasmodium falciparum (isolate Camp / Malaysia). GN=PFMC_04592 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MNHLGNVKYLVIVFLIFFDLFLVNGRDVQNNIVDEIKYREEVCNDEVDLYLLMDCSGSIR
RHNWVNHAVPLAMKLIQQLNLNDNAIHLYASVFSNNAREIIRLHSDASKNKEKALIIIKS
LLSTNLPYGRTNLTDALLQVRKHLNDRINRENANQLVVILTDGIPDSIQDSLKESRKLND
RGVKIAVFGIGQGINVAFNRFLVGCHPSDGKCNLYADSAWENVKNVIGPFMKAVCVEVEK
TASCGVWDEWSPCSVTCGKGTRSRKREILHEGCTSELQEQCEEERCPPKWEPLDVPQEPE
DDQPRPRGDNFAVEKPEKNIIDNNPQEPSPNPEEGKGENPNGFDLDENPENPPNPDIPEQ
KPNIPEDSEKEVPSDVPKNPEDDREENFDIPKKPENKHDNQNNLPNDKSDRYIPYSPLPP
KVLDNERKQSDPQSQDNNGNRHVPNSEDRETRPHGRNNENISYNRKYNDTPKHPEREEHE
KPDNNKKKGGSDNKYKIAGGIAGGLALLACAGLAYKFVVPGAATPYAGEPAPFDETLGEE
DKDLDEPEQFRLPEENEWN
Download sequence
Identical sequences A0A024X2Y1 W4IZV9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]