SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A024X9I9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A024X9I9
Domain Number - Region: 87-124
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.000405
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A024X9I9
Sequence length 282
Comment (tr|A0A024X9I9|A0A024X9I9_PLAFC) Uncharacterized protein {ECO:0000313|EMBL:ETW61431.1} KW=Complete proteome OX=5835 OS=Plasmodium falciparum (isolate Camp / Malaysia). GN=PFMC_02851 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MVKIGKKLKGFNEGIPKLNTNISDKIIKEKEENDSEERERQREKYKNEKEHELNEMIFEH
DDQQNIHEQYRKLYLENIKDSKIYIHDDLQYYLEKNNIPTFLVLLLYRILIEKPENIIKF
IIDQIYVFLFTKTETNKKKHALLKPLECTFQQSCEEKEKKTKKEQDENNMINSLDGDMNP
SFHESINDALQKNNNLIESINYESFIKQHFFGLDNILEVVDFLKIENTEEIYYNNLIHII
KNFQNPINNQILQRENVSYGQTISLNKALCLSETIYNNYFYN
Download sequence
Identical sequences A0A024X9I9 W4J3J3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]