SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A024XD28 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A024XD28
Domain Number - Region: 29-96
Classification Level Classification E-value
Superfamily Staphylocoagulase 0.0131
Family Staphylocoagulase 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A024XD28
Sequence length 147
Comment (tr|A0A024XD28|A0A024XD28_PLAFC) Uncharacterized protein {ECO:0000313|EMBL:ETW62701.1} KW=Complete proteome OX=5835 OS=Plasmodium falciparum (isolate Camp / Malaysia). GN=PFMC_01435 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MSYGWLTESTIYKKKEEIIELSKDKLSKENKNNKKNENSIDKLNSIVDSYLQNIKQNKKN
EIGKKKISYHEKLYKDKNEGVDKRIEQDKKSLSIKKQINKKKKKYEELKQKGLNDINCLV
NFEAKQQAECELEEIRKLKEMEKGKQK
Download sequence
Identical sequences A0A024V9N4 A0A024WUX5 A0A024XD28 A0A0L1I2W0 A0A0L7K6X0 A0A0L7M0F6 W4ISW1 W7FGT9 W7GA44
PFHG_00579T0 PFDG_01829T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]