SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A024XDW1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A024XDW1
Domain Number 1 Region: 43-90
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000562
Family TSP-1 type 1 repeat 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A024XDW1
Sequence length 113
Comment (tr|A0A024XDW1|A0A024XDW1_PLAFC) Circumsporozoite protein {ECO:0000313|EMBL:ETW63669.1} KW=Complete proteome OX=5835 OS=Plasmodium falciparum (isolate Camp / Malaysia). GN=PFMC_00416 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MPNDPNRNVDENANANNAVKNNNNEEPSDQHIEKYLKRIQNSLSTEWSPCSVTCGNGIQV
RIKPGSANKPKDQLDYANDIEKKICKMEKCSSVFNVVNSSIGLIMVLSFLFLN
Download sequence
Identical sequences A0A024WW42 A0A024XDW1 W4ISG3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]