SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A024XES7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A024XES7
Domain Number 1 Region: 3-110
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000971
Family Pleckstrin-homology domain (PH domain) 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A024XES7
Sequence length 120
Comment (tr|A0A024XES7|A0A024XES7_PLAFC) Uncharacterized protein {ECO:0000313|EMBL:ETW63959.1} KW=Complete proteome OX=5835 OS=Plasmodium falciparum (isolate Camp / Malaysia). GN=PFMC_00195 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MEIVNEGWVFKQSKYLKKLRKRYIILTKNFICSFKSEYYQAEKPTEILYLNKFTELTSLE
DIRKIKHAENELGLSNIHLFNISYKNRNILFVTVDENEKNKWIKHISKQMVKPTVLFLNI
Download sequence
Identical sequences A0A024XES7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]