SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A024YTY7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A024YTY7
Domain Number 1 Region: 23-156
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000000000484
Family SMI1/KNR4-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A024YTY7
Sequence length 205
Comment (tr|A0A024YTY7|A0A024YTY7_9ACTN) Uncharacterized protein {ECO:0000313|EMBL:EYU69892.1} KW=Complete proteome OX=1460244 OS=Streptomyces sp. PCS3-D2. GN=AW27_09725 OC=Streptomyces.
Sequence
MTENARIKALEQIMPATHGADEDVDWLAAEAAWGIRFPSDFIAFMGRFGAGSINGEASIL
LPMPTPGLQWDPAEMAEETANARQMWVAEGGRSAFGVDPESIIAWGVTGGSDILCWLTTD
PDPDRWPVLVCGRHTADSFAVYPYGMAEFLHRLCSDEFDVSPVSITFWDGGHLSFVHWRK
AQRRWQEGRNPETGEPDPYAGEFTD
Download sequence
Identical sequences A0A024YTY7
WP_052030297.1.95598

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]