SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A024YUC0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A024YUC0
Domain Number 1 Region: 24-158
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000000000000353
Family SMI1/KNR4-like 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A024YUC0
Sequence length 183
Comment (tr|A0A024YUC0|A0A024YUC0_9ACTN) Uncharacterized protein {ECO:0000313|EMBL:EYU70236.1} KW=Complete proteome OX=1460244 OS=Streptomyces sp. PCS3-D2. GN=AW27_00420 OC=Streptomyces.
Sequence
MRGTEAVAALAELMPVTVGVDEQVDWDEVEAAWGTRFPSDYVRFMEVYGSGAISDGISIL
LPSLRAEGYPYRDGPGLRDETENARETWEMCRDGADFDVDPESIVAWAVTSGADIYCWVT
TDEDPDRWPVLICGRHTDPEMQLHPLGMAEFLHRLLSDAVFRKGKISTSLQDEVSFVNWR
NEL
Download sequence
Identical sequences A0A024YUC0
WP_052029988.1.95598

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]