SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A025C8R4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A025C8R4
Domain Number - Region: 30-61
Classification Level Classification E-value
Superfamily HIT/MYND zinc finger-like 0.00994
Family MYND zinc finger 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A025C8R4
Sequence length 114
Comment (tr|A0A025C8R4|A0A025C8R4_ECOLX) Uncharacterized protein {ECO:0000313|EMBL:EYV12107.1} KW=Complete proteome OX=1446596 OS=Escherichia coli O145:NM str. 2010C-3526. GN=BX51_17245 OC=Enterobacteriaceae; Escherichia.
Sequence
MPSAPVVNAEPPRQHGTSRMPAFAGINGSSFLAICSPCPTVPYCPFDRSAFGWLRRLMSC
TSCRQWSAGMMSLYLHTAPPGVTVLRRANCLIRGSGLSNVSGNGSPSPYDIPLD
Download sequence
Identical sequences A0A025C8R4 A0A027U063 Q7Y2I9 Q8SC34
gi|20065944|ref|NP_613027.1| NP_859393.1.60722 Q7Y2I9_9CAUD Q8SC34_9CAUD

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]