SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A026W552 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A026W552
Domain Number 1 Region: 64-157
Classification Level Classification E-value
Superfamily TIMP-like 4.24e-26
Family Netrin-like domain (NTR/C345C module) 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A026W552
Sequence length 158
Comment (tr|A0A026W552|A0A026W552_OOCBI) Netrin-1 {ECO:0000313|EMBL:EZA51123.1} KW=Complete proteome; Reference proteome OX=2015173 OS=Ooceraea biroi (Clonal raider ant) (Cerapachys biroi). GN=X777_10444 OC=Vespoidea; Formicidae; Dorylinae; Ooceraea.
Sequence
IVLKMPRLRQEFTKFVFKPRNRRERSVTRTTTAHSILRSEPILGRITDRHKKSDGSQAGT
SVSGTSWIRFTLNIDFIYKKNPSSRIRRGDISLYVHSSDLACRCPKIKPNKSYLILGQEN
DGGGQGGLTVTQRSIVIEWRDEWHRRMRRFQRRARSCH
Download sequence
Identical sequences A0A026W552

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]