SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A026WF43 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A026WF43
Domain Number 1 Region: 141-204
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000167
Family VWC domain 0.037
Further Details:      
 
Domain Number 2 Region: 2788-2848
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000209
Family VWC domain 0.03
Further Details:      
 
Domain Number 3 Region: 49-112
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000022
Family VWC domain 0.03
Further Details:      
 
Domain Number 4 Region: 232-297
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000022
Family VWC domain 0.019
Further Details:      
 
Domain Number 5 Region: 1483-1552
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000303
Family VWC domain 0.019
Further Details:      
 
Domain Number 6 Region: 2885-2928
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000067
Family Fibronectin type I module 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A026WF43
Sequence length 2945
Comment (tr|A0A026WF43|A0A026WF43_OOCBI) Uncharacterized protein {ECO:0000313|EMBL:EZA53619.1} KW=Complete proteome; Reference proteome OX=2015173 OS=Ooceraea biroi (Clonal raider ant) (Cerapachys biroi). GN=X777_06883 OC=Vespoidea; Formicidae; Dorylinae; Ooceraea.
Sequence
MSALNAAPCRRGIILWLAAVLLLASRSTHSAPVYDQDTTQIAEYDGAVTGCYFNFQRYQE
GDRIITSEPCLNCTCHNRMLMCYLKVCPFTKAIGQDCTVEKRPDQCCPVITCPEVPVQLL
TSTTSAPAISDSTDVGFHDNYGCHVDERFYPDGAMLPVEHHNPCELCYCIRNRTTCVMQE
CTLRVAGCKPVYQPGVCCPIKYNCEYDEEPSTTVGPTPGLIMTTTLPPGMLPQCFYEGKI
YEDGDLIYSTQPCQHCYCFRGEIACAVQNCGTPMEAHGKNCTALPPPEGECCPTTYQCEE
GEQGTITLPEEGEEQLPEQVAHDLEMTESPMVIDQEDQQVKGEHPQQEAFPGADNVIPQV
PEEEEEGVHGTIEHVTQGHIPSTEKPEEPKEQAATLPTEENVVPETETTEKESIPSHEHV
TETSPAEMASEEVITAKVPSETEVTKTEAPTTMQEIETATEAPAVELPGATSQGPHPEEE
TVTTEPEKHASTEKSEIEKEQSTEPSVSEEIQTEGVIKTEPEVPTSPHEGFSTQVPEEVT
EKATEEEQVSTTKAPEQPEISTEIIEKVTSPVAEIEEPSVSIVPEHVTEQEKEDESKVET
TPGEIQAAEIPSELPVEQPTATMAHEIPSIEQAATEKGEVSHPTETAVIEEAQTTEVSGH
PEEPSTQQEQKPVAGEGEEEQRPEQPTSEHAIIEGDLTESPAMGEEPITTEKQHVEKEIT
PEIPAQGPTGIPIPERSPEQKAEDENVYHVTEDYRDVTRPEISPDNLMTELPQKTSEASP
PQEQEATPTPSEETEKPILEEATEVTLSSQTESKPEIVETSTSTEKTKAESTSAVTEIQA
STESSATTIKEHVPEEKAPEEAPSSEELPMKGLGVEESEEISGEQVEKEVHPKKELSSEE
EPSVATQPVPETSSSIPAEHEQSTEPGEEQTSEGEHVTTVIPSVEQSTHAKQDEEKETET
VPIEEEKAVTSEKPIERVTGESVEKSTTQKPTIEESKTEQPKEYFTEKAPEEVTVTENHD
VQETKAPEKKPEEIEGPKGVSPEGTEEPTEATVTEKELPKETEERKPTEVTGIEQTELPA
IEEHPTKLGEIEKEGEEKISVPASTEETGLAIETESTKVPAEEQQTEEMHTEPSASKEHL
PSQPSIPSDRKEDQEPVEPKPSEEEKEIQEQITQKPSLEEIEVTKTQEEPQQPNLLSETE
GTHIPSSEETVTEGTLPEEKPGEAATQSAVERQPEIVSEQPKEVTTELSGQEEQTQIPII
EEQPEIHIRKETEPPGIVTPEEPSLTPSSAVSEGPVTGEKGADVSKSTEAAISEGTTISV
SISEVSTVSPELEEHTEHEGTVPIEKEIVTEFTPSEKEQPEVTHPLTTEEKPSKESGEAE
IIPPEVYTEETISETPEIPVIEQHPHEPEEVPKETITETPIHKEHEEHSTIAPEEIPEVK
ITTEVPLKEVPQDSTEHPTSTPEKTSVEEETTSEIVPRPLGIPGEGNCLVEGQSYNNNSA
VPPANICQTSCRCISSIVQCELVECPAPPVHLSNCMPVHTGGESCCPMYACDSTPTAELE
SDSHMVQPHTPEAEEGKEGVPSTEVSTEAPAAEVTEAAKEPSIVTDEIHTPESQPATEVA
IPSISPSEEAGVTEIKEQQTTLKPIEPVYEQTTIGQPIKQHEEHTISSVPETSQEPEEHT
QLPGESTESKVSEEEEGVTKVPTEQPQEEIVIPVSGGEVITSTESHSAEKQSSTVSHKEE
ETHIPVEITTIAAGKEKTTISIKEQEMPTKEISIKEQSTPESVETSEETGKEQPITSEEP
STVEEHETPTKLEVPVLTEEPVKSELPEKQQPVEPTEYETTSVSEIQSTITHKPEEGQEI
ITSSEGEQITQTEKSESDLQTKVPETETQGPIVSTPESTTFILHDHTVTELPLNHVTDHV
TVKSMEVSTEESKEEESEVSTKVPGIEEEHVTIPIKVEVPSEGITEQELEKPTEETVKPA
QESTSEIPHKEILPETIGSTESAAGTTEHVEEHPEPSLAEHEEEPSVTKLSEEKPIEPEI
PVSTEQPVKAVEEASEAELEKTTKPTVAHEFESTQVSVEEHPEVTSETESHEPELSVQEH
TTIGEETITFAPAQEELGEHPITSIIKETEPSLSEAETEQPIVSEVESEAPVVEHVTVTT
EEQTPKSEEHPIEEQTASPVPSKDETTEGAVLEETSESVTSQKEQVTEKPIESAKPETEV
SNVTEEQTVAPEVQKGVEEEEQQKPEGITEEIGKEQPVPEVTEVGHEGTTEETVKEEVTS
ILEEHTSVEEHPEQEVTPSEMEPGVKVEPMKPETTSGPIEEKPKEEGEVSEAPLPEQPTS
EEATIASLIPEEHPTVSTETKEKESTEKPEYQTTLSTAEEEVSKPATEASEVEKLSPEEE
SATAEVATVKPEQPATIVPVEVSPTEKPAEVLPETERPTVSEQETASPEQQGETTTKAIE
TAITEEEIPEEKVPVETILEEEEKPSEAPKAGVEEETHPSVPVETTPIHEEEEPSITKLQ
PTEEPLPSEGETLVPEIQPSQSEEGEVTYPGIAEEGEHPGVPEEGHPISGIPEEPQFTTE
HAAEVPVTIKEEEHPETEQSEISSEVPMPTEGPIKVSGTPIELPEEQITVRPVPSEEPIP
EVPTRPEESTETSVEQHVIKVPAELPTAETPEEIPEEEVVHPQEGVEIGHPHIDHFPEVT
MRPEPDYSELTFGSDEEHLRPVNHTEVTKRPYQPGFHEQQPTTLAPHIPEYPDQIVSGED
NPHFPVQGGSYLNHDEDYDEDDQVYGPGTCRYGGKVYVSAQQIPRDDPCDFCFCFRSDII
CLQQSCPPPIPGCHEEPISGFCCPRYECPVSMATALNLTTTTTTTTTTLPPHFPAHAYKG
AARRNGCQISGKTYRVGEVIKSASGPCLHCTCGGDGNMKCDPRICTPEPMLRQMIAAVAA
ERRRR
Download sequence
Identical sequences A0A026WF43
XP_011339917.1.87679

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]