SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A026WRB2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A026WRB2
Domain Number 1 Region: 45-173
Classification Level Classification E-value
Superfamily C-type lectin-like 4.72e-19
Family C-type lectin domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A026WRB2
Sequence length 194
Comment (tr|A0A026WRB2|A0A026WRB2_OOCBI) Oxidized low-density lipoprotein receptor {ECO:0000313|EMBL:EZA58575.1} KW=Complete proteome; Reference proteome OX=2015173 OS=Ooceraea biroi (Clonal raider ant) (Cerapachys biroi). GN=X777_14737 OC=Vespoidea; Formicidae; Dorylinae; Ooceraea.
Sequence
MLIAIMNVVFGAIEKLVYRVDYLEKRVRRAEELLYYVIAGNNKMKEPCPANYTRMGQNCY
HFSNRDFNWKSSASLCRGMGGHLVEFDSIEESQDVIAGLMSDSNLKGKNFWTGGLNPGLL
WIWAFLCHAQVTLTLKNVLNFRCLKLTYNASSKIYSYRGEDCGLRQRYICELTVDDESAN
KIERTARLLIDKDN
Download sequence
Identical sequences A0A026WRB2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]