SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A031GUI5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A031GUI5
Domain Number 1 Region: 4-169
Classification Level Classification E-value
Superfamily Lipocalins 2.62e-51
Family Retinol binding protein-like 0.00000663
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A031GUI5
Sequence length 170
Comment (tr|A0A031GUI5|A0A031GUI5_9BURK) Outer membrane lipoprotein Blc {ECO:0000256|PIRNR:PIRNR036893} KW=Complete proteome OX=29581 OS=Janthinobacterium lividum. GN=BW37_01627 OC=Oxalobacteraceae; Janthinobacterium.
Sequence
MKKLLFLCVLVLAGCVGRPENIVPVSNFDTTRYLGKWYEIARLDHSFERGLSHVTADYSL
RQDGGLKVLNRGYKDADAVWKDAEGKAYFVDKKDVGYLKVSFFGPFYGSYIVFDLDQQNY
SYSMISGPDKSYFWLLSRTPTMDPALQQRLIEKAGGLGFDTSKLIYVKQN
Download sequence
Identical sequences A0A031GUI5
WP_034750114.1.69675 WP_034750114.1.74280

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]