SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A031GX12 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A031GX12
Domain Number 1 Region: 13-166
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000000000000536
Family SMI1/KNR4-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A031GX12
Sequence length 217
Comment (tr|A0A031GX12|A0A031GX12_9BURK) SMI1 / KNR4 family protein {ECO:0000313|EMBL:EZP41021.1} KW=Complete proteome OX=29581 OS=Janthinobacterium lividum. GN=BW37_00970 OC=Oxalobacteraceae; Janthinobacterium.
Sequence
MSNYYTRYRHLAIEDAKHAPTARQIAAIEALLEAPLPAAFLAFLKVANGACFDYTCDVPD
GNGGVEKMGFNTFFSADEGDFCDETLVGEIRAARKHTDMPVRILPFARDGGNSMVYLDLT
EEGGGRVLAYVQELPDWTGKRAHGLMELAPSFDAWLDSLYIDRDTVLDELEHSVSEPSHL
DAMAEWLDIGMPAWRRDAGITALFALKQVELCANEQD
Download sequence
Identical sequences A0A031GX12
WP_034748237.1.69675

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]