SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A031HAR3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A031HAR3
Domain Number 1 Region: 201-289
Classification Level Classification E-value
Superfamily TolA/TonB C-terminal domain 0.00000000000000445
Family TolA 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A031HAR3
Sequence length 291
Comment (tr|A0A031HAR3|A0A031HAR3_9BURK) Cell envelope integrity inner membrane protein TolA {ECO:0000313|EMBL:EZP45190.1} KW=Complete proteome OX=1468410 OS=Delftia sp. RIT313. GN=BW39_05990 OC=Comamonadaceae; Delftia.
Sequence
MIAPPPPPKPQAVDDDREAEIALEKKRKIEQQKKERAEQAAREQREKERQERLDKEKADK
AAKDKAEREKAEKAEKDRRDKLEQQKKDKAEQDRKERLEQQKKDKAEKEKADKEKAAKDK
AEREKAEKADKEKAAKAEAEKKAAEDKRKKEQAAKEAREAKEAEARRLENIRRMQGLAGS
GGSAGEGAGGSKSGGSGSSAGGPSAGYGAKVAARVKPNIVYPDAISGNPRAEVRVRTAPD
GTITGATIAKSSGNKAWDDAVIRALQKTETLPRDIDGRVPSDLVIGFRPQD
Download sequence
Identical sequences A0A031HAR3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]