SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A031IWM3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A031IWM3
Domain Number 1 Region: 12-81
Classification Level Classification E-value
Superfamily ISP domain 0.0000000000498
Family Ring hydroxylating alpha subunit ISP domain 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A031IWM3
Sequence length 105
Comment (tr|A0A031IWM3|A0A031IWM3_9PSED) Uncharacterized protein {ECO:0000313|EMBL:EZP65608.1} KW=Complete proteome OX=1470593 OS=Pseudomonas sp. RIT357. GN=BW43_03208 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MKAISLNITHAHYVAVEDRTYFLKRHAYSTQLLPTSCPHRGGPLHMGEVTGDGQSVICPW
HDNAYKVCNLEKKALPTVRVRNQISTVVGDTERCVPLLKLSRYDG
Download sequence
Identical sequences A0A031IWM3 A0A257BYE9 A0A2G5MGA9
WP_032887730.1.58638

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]