SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A031LQC2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A031LQC2
Domain Number 1 Region: 139-251
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 7.85e-38
Family Archaeal tRNA CCA-adding enzyme substrate-binding domain 0.0002
Further Details:      
 
Domain Number 2 Region: 236-409
Classification Level Classification E-value
Superfamily PAP/Archaeal CCA-adding enzyme, C-terminal domain 3.14e-31
Family Archaeal tRNA CCA-adding enzyme 0.0068
Further Details:      
 
Domain Number 3 Region: 3-180
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 2.77e-30
Family Archaeal tRNA CCA-adding enzyme catalytic domain 0.00061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A031LQC2
Sequence length 410
Comment (tr|A0A031LQC2|A0A031LQC2_9CREN) tRNA-NT {ECO:0000256|HAMAP-Rule:MF_01264} KW=Complete proteome; Reference proteome OX=1160895 OS=Candidatus Acidianus copahuensis. GN=CM19_06070 OC=Acidianus.
Sequence
MEKEVLERIKPSKDDFEKINNTVEEVLEALKGFEAEVHGSFRKGTWLKGDTDVDIFVFFP
KELGKEYMPNALKLIEDRLRKFNYQINYAEHPYIIIKNNGMEIDVVPALRVDSGENAVTA
VDRTPFHTALINSSLTDEQKDQVRLLKRFMKGIGTYGAEIKVKGFSGYVCELLILNYGSF
REVLKASSDWRPPVKILIRQPTVVFDSPLIIVDPVDPRRNAASAVSLKKLGEFSIASKFY
LEKPSIDFFFPPEVNEVDIKGEVLVSEILLQENVSQDVLWGQINSSVTRIRNQLKSKGFE
VIDVQAYGNDRKIIIATQISSRFPPQYYLNLGPPFYVNAKGFFKKNENVWVGDDGNLYSI
KKREITPAEDVVKLSIQVKHKYSLREYWLSERPKDPCLKQFLRKTPAWLK
Download sequence
Identical sequences A0A031LQC2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]