SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A034T021 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A034T021
Domain Number 1 Region: 28-150
Classification Level Classification E-value
Superfamily PapD-like 1.96e-40
Family Pilus chaperone 0.00000194
Further Details:      
 
Domain Number 2 Region: 153-239
Classification Level Classification E-value
Superfamily Periplasmic chaperone C-domain 2.35e-22
Family Periplasmic chaperone C-domain 0.0000101
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A034T021
Sequence length 243
Comment (tr|A0A034T021|A0A034T021_9GAMM) Gram-negative pili assembly chaperone protein {ECO:0000313|EMBL:GAJ66156.1} KW=Complete proteome OX=1263550 OS=Edwardsiella piscicida. GN=MA13_contig00001-0279 OC=Hafniaceae; Edwardsiella.
Sequence
MFKLSRAMNKTVMVIACLNFSPLSQAAISLDRTRAIFNGGERSMTLNIANDNKQLPYLAQ
AWLENDKQEKITTGPLIVTPPVQRLEPGAKSMVRIASTAEISSLPQDRESLFYFNLREIP
PRSEKANVLQIALQTKIKLFYRPKAIATQPNAVWQDQLVLNKVSGGYLIDNPSPYYVTVI
GLGANAKQAQDGDFEAVMLAPKSSRTVKSGSYTTPYLSYINDYGGRPVLQFVCTGDRCSA
LKK
Download sequence
Identical sequences A0A034T021
WP_071844150.1.32312 WP_071844150.1.69651

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]