SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A034T2J0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A034T2J0
Domain Number 1 Region: 13-173
Classification Level Classification E-value
Superfamily Lipocalins 1.81e-45
Family Retinol binding protein-like 0.00000225
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A034T2J0
Sequence length 174
Comment (tr|A0A034T2J0|A0A034T2J0_9GAMM) Outer membrane lipoprotein Blc {ECO:0000256|PIRNR:PIRNR036893} KW=Complete proteome OX=1263550 OS=Edwardsiella piscicida. GN=MA13_contig00003-0056 OC=Hafniaceae; Edwardsiella.
Sequence
MKAWPALCAVPLALLLAACRSPAPPRGVEPLRGFDVARYLGTWYEVARLDNRFERGLTQV
SAHYALREDGGISVLNRGYDAQRRRWRQSQGKAYFITGPTTAALKVSFFGPFYGGYNVIA
LDDDYRYALVCGSNRRYLWILSRTPTLPPAVRQAYIRRAGALGFAVEQLRWADG
Download sequence
Identical sequences A0A034T2J0
WP_045425054.1.32312 WP_045425054.1.69651

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]