SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A034T775 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A034T775
Domain Number 1 Region: 5-166
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 1.57e-19
Family SMI1/KNR4-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A034T775
Sequence length 169
Comment (tr|A0A034T775|A0A034T775_9GAMM) Uncharacterized protein {ECO:0000313|EMBL:GAJ67907.1} KW=Complete proteome OX=1263550 OS=Edwardsiella piscicida. GN=MA13_contig00007-0215 OC=Hafniaceae; Edwardsiella.
Sequence
MNELWKDLERWLQAHRPALLDDLNSPASGAEIRDLEQVIGASLPADFTACLLVHNGQKGL
GGWLFGSWEFLSTQNILMSWSVWRDLLEEGDFEGKVARPAEGIRPGWWLPGWIPFASNGG
GDYLCLDLTPAVGGDYGQVINVFHDVADRVVEMRSFSAWFTRFVVDKRV
Download sequence
Identical sequences A0A034T775 A0A076LU60
WP_034163796.1.20341 WP_034163796.1.32312 WP_034163796.1.45880 WP_034163796.1.69651 WP_034163796.1.86133 WP_034163796.1.93273 WP_034163796.1.9786

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]