SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A034THE8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A034THE8
Domain Number 1 Region: 4-194
Classification Level Classification E-value
Superfamily beta-Roll 4.1e-21
Family Serralysin-like metalloprotease, C-terminal domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A034THE8
Sequence length 197
Comment (tr|A0A034THE8|A0A034THE8_9VIBR) Structural elements {ECO:0000313|EMBL:GAJ71487.1} KW=Complete proteome OX=1298599 OS=Vibrio sp. JCM 18904. GN=JCM18904_2257 OC=Vibrionaceae; Vibrio.
Sequence
MSASDNDTYLGDAGVNNQFADFDGGDDLFIGFGGNDSFVGGGGNDYVIGGDGDDRLTGGA
GDDILRAGTGNDYLGGGTGNDLLLGLLGDNKLNGGVGEDILVVGSGDNVLVGGSNGDKFV
FTDKFGGHGEAKVVDFIIGEDSLHIISDSVTDFGDLSFSYDAVGNAVFTDGGADLTVKLI
GVTETDINTYGADLFVI
Download sequence
Identical sequences A0A034THE8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]