SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A034TNC1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A034TNC1
Domain Number 1 Region: 10-124
Classification Level Classification E-value
Superfamily PH domain-like 9.84e-38
Family BPHL domain 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A034TNC1
Sequence length 125
Comment (tr|A0A034TNC1|A0A034TNC1_9VIBR) GTPase {ECO:0000313|EMBL:GAJ74578.1} KW=Complete proteome OX=1298600 OS=Vibrio sp. JCM 18905. GN=JCM18905_301 OC=Vibrionaceae; Vibrio.
Sequence
MIDFDNSSVFKLKPIEVSKVREDFHKFLIDGESVFAGFKTVRDQVVFTNKRVIAANVQGI
TAQKWDYTSLPYSKINAFSIETSGTFDLDCEIEFFMSEVGRVRFEIKGSFDLISFNRMVS
EYVLA
Download sequence
Identical sequences A0A034TNC1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]