SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A034TZW9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A034TZW9
Domain Number 1 Region: 138-271
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 6.2e-25
Family AadK C-terminal domain-like 0.0035
Further Details:      
 
Domain Number 2 Region: 8-131
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 7.52e-19
Family AadK N-terminal domain-like 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A034TZW9
Sequence length 275
Comment (tr|A0A034TZW9|A0A034TZW9_9NOCA) Uncharacterized protein {ECO:0000313|EMBL:GAJ79455.1} KW=Complete proteome OX=1206724 OS=Nocardia brasiliensis NBRC 14402. GN=NBRGN_012_00050 OC=Bacteria; Actinobacteria; Corynebacteriales; Nocardiaceae; Nocardia.
Sequence
MDDGFVMRVVEWARGRGDVRVVLRTGSRGRVGGAVDALSDHDVEVFTTDPERYAGDDGWV
RELGEVWVNIELEGPYDNPAHLVFFDGGVKADFQILPVDLLSEFAADGLDELHERGYQVL
FDRDGIAARLPAATGASPVLELPDQQEFTAHCAEFWFEIAHLPRYSARGDLWVVRSRDQE
TKDLLLTMIEWHAVTHHGAGHDVWHGGTKMRDWAAPGVWQRVEAIFAIGDPLRQAQATAD
LFADLAKTVAASQNLDYPAAAEKAVRPYLDQLPQR
Download sequence
Identical sequences A0A034TZW9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]