SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A034V1L8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A034V1L8
Domain Number 1 Region: 1806-1864
Classification Level Classification E-value
Superfamily BPTI-like 1.05e-18
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0017
Further Details:      
 
Domain Number 2 Region: 1882-1940
Classification Level Classification E-value
Superfamily BPTI-like 1.16e-18
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0021
Further Details:      
 
Domain Number 3 Region: 2440-2525
Classification Level Classification E-value
Superfamily Immunoglobulin 2.66e-18
Family I set domains 0.015
Further Details:      
 
Domain Number 4 Region: 1726-1781
Classification Level Classification E-value
Superfamily BPTI-like 4.68e-18
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0022
Further Details:      
 
Domain Number 5 Region: 2687-2765
Classification Level Classification E-value
Superfamily Immunoglobulin 2.25e-17
Family I set domains 0.015
Further Details:      
 
Domain Number 6 Region: 1667-1723
Classification Level Classification E-value
Superfamily BPTI-like 6.1e-17
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0023
Further Details:      
 
Domain Number 7 Region: 1489-1544
Classification Level Classification E-value
Superfamily BPTI-like 6.81e-17
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0018
Further Details:      
 
Domain Number 8 Region: 1608-1663
Classification Level Classification E-value
Superfamily BPTI-like 3.83e-16
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.002
Further Details:      
 
Domain Number 9 Region: 1966-2024
Classification Level Classification E-value
Superfamily BPTI-like 5.11e-16
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0044
Further Details:      
 
Domain Number 10 Region: 2094-2148
Classification Level Classification E-value
Superfamily BPTI-like 5.25e-16
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0078
Further Details:      
 
Domain Number 11 Region: 2537-2615
Classification Level Classification E-value
Superfamily Immunoglobulin 5.33e-16
Family I set domains 0.037
Further Details:      
 
Domain Number 12 Region: 2154-2207
Classification Level Classification E-value
Superfamily BPTI-like 0.00000000000000138
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0035
Further Details:      
 
Domain Number 13 Region: 2025-2079
Classification Level Classification E-value
Superfamily BPTI-like 0.00000000000000142
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0074
Further Details:      
 
Domain Number 14 Region: 1548-1603
Classification Level Classification E-value
Superfamily BPTI-like 0.00000000000000156
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0041
Further Details:      
 
Domain Number 15 Region: 2217-2276
Classification Level Classification E-value
Superfamily BPTI-like 0.0000000000000027
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0024
Further Details:      
 
Domain Number 16 Region: 61-116
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000445
Family TSP-1 type 1 repeat 0.0024
Further Details:      
 
Domain Number 17 Region: 180-240
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000523
Family TSP-1 type 1 repeat 0.0062
Further Details:      
 
Domain Number 18 Region: 358-412
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000353
Family TSP-1 type 1 repeat 0.0028
Further Details:      
 
Domain Number 19 Region: 2356-2404
Classification Level Classification E-value
Superfamily Elafin-like 0.0000000484
Family Elafin-like 0.0015
Further Details:      
 
Domain Number 20 Region: 299-352
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000017
Family TSP-1 type 1 repeat 0.004
Further Details:      
 
Domain Number 21 Region: 18-47
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000017
Family TSP-1 type 1 repeat 0.006
Further Details:      
 
Domain Number 22 Region: 120-177
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000103
Family TSP-1 type 1 repeat 0.0045
Further Details:      
 
Domain Number 23 Region: 244-296
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000523
Family TSP-1 type 1 repeat 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A034V1L8
Sequence length 2819
Comment (tr|A0A034V1L8|A0A034V1L8_BACDO) Papilin {ECO:0000313|EMBL:JAC36404.1} OX=27457 OS=Bactrocera dorsalis (Oriental fruit fly) (Dacus dorsalis). GN=PPN OC=Tephritoidea; Tephritidae; Bactrocera; Bactrocera.
Sequence
YEYSIPEELSKSTPVEYSWTHSEFEPCSAPCGGGTQTRNVTCTYEYSIPEELSKSTPVEY
SWTHSEFEPCSAPCGGGTQTRNVTCTNRMTLEEVDPNLCDASAKLPEEQACNEQPCAPSW
VEGEWGKCSKGCGADGVQNRTVTCERISPNGTHTTEEDSVCLENVGNKPATEQECNRDVK
NCPKYHLGPWAPCDKLCGEGKQKRKVTCYIEENGRKRVLPEEDCVEEKPPTEKECILTPC
EGVDWILSEWSGCEECGQKTETRTAVCASKSGKIYPEEFCAPEVPALSRPCKSSKCTPKW
FTSEWSKCSAACGKGVQSRIVICGEFDGKSIKPAEESKCDASAKPESEQECEGEEKECPG
QWFTGPWDPCSKPCGGGERTREVFCLSNGTKSLNCDESKIESLSEKCNTQACTKDELIPV
DSTASPLTEDAEEDDCEEDDEDDLVSKEDLKLAEGFELDKETTAPVSLLTDELMFSDSPY
TEESSDIASTDIPLTTVEGSGEGTDITEDTSLVSEGSGDEFSSTVGASDTTESVGSTTSP
ISTDSSLSTESSISTDSTKSSEATDTTEEASDSTTVSASSSETTGTSESSVSTESSKSPD
TTDSTVASSSSETTGTSESSVSTESTESSDTTDSSDTTDVSESSVSTESSVSPDTTQSSE
SVSTDSSLSTETTEILGSSGSTDSSETTETPESTESSASPESTQSTASEGTDQTSSIQSS
ASTVSGSTEPTESTVSAETTETAGSTESTVSSSSDSTQSTESTESTSTDTTESTSTDTTE
STVSSSTDSTESTTEVSTESSISTESISTDSTESTESSSEFSTLSTDSTQSSVSVDTTGS
PLSTESTGSSSDITGTTADVSSDSTVTQSTVSTETSVSTESETGSPVSIDSTTGSSDSTD
TTSAATSDVTTESSETSISSEATTSSDSSDTTEISESSTDVSSTTDSGISETTADSSGST
ESETTEVSGSTDISESTASGSTEESTTGGSTESTTEGVSVESTSDISTTEGSSSSTEAGE
STQSSDTTEGVSTGSAETTESGPTESTQTTESGATDSAFESSTVDIWSTTDEDEESTPNT
LEALITKAPKQKKCKAKKDCKKSTYGCCPDKKTPAKGSFDKGCAIVKTCAETKYGCCSDG
VSPAEGENNEGCPQSQCAETLFGCCPDNFTPAEGEDAEGCPETTTAPPTTTVELVTEGSG
ETTDTPESTISTETPETTETPESTETPESTETPESTEIPESTTESKVVKSCSFSEFGCCP
DGTTEAKGKDFEGCESAAPTASNCRDTEYGCCPDGLTAATGSDYAGCAPCTREPYGCCPD
NQTPAHGPLGEGCCLNTVYGCCPDNINAARGPNFEDCDCKYTPYGCCDDQKTASRGPNKE
GCGCENSTHGCCPDKITPANGPKFEGCACHTLQFGCCPDGITIAQGPHHYGCHCSQTEFK
CCPDEKTPAKGPDGEGCTCLESKYGCCPDGIAAAEGDKFEGCASVKEPPQKACGLPKATG
PCGNFSIKYFFDTSYGACARFWYGGCEGNDNRFETESDCKSTCQEYTGKEACFLPKSSGP
CTGYNKKWYFDTDRNRCEEFNYGGCYGTSNRFDSLAECQALCAVDDTTPPCDQPMEAGPC
EGNFERWFYDNQTDVCRPFNYGGCKGNKNNYPTEHACNYHCRQPGVHKDYCSLPKQTGDC
SEQHARWHYSDVDKRCMPFYYTGCGGNKNNFPTQESCEDHCPKEVVKDVCEIPAEVGACT
DYTSMWYYDTKEERCRQFYYGGCGGNDNKFATEEACLQRCEKKPEPEPEPPREPEPEPAP
APAPAPSSREACQLDRDPGDCRSYVSQWFFDRETQQCRNFYYGGCGGNANRFNTLEECNQ
LCGEGPPAPAPAPAPVGPPAASTDICDMPADQGDCDTYAIKWTYDNTEGRCKEFFYGGCG
GNENRFETEAACTDRCLSPVNNIAVRFGADEEAPVVAPAPAPDSAEDNTCTLPAYYGSCA
DNNQTRWYYNYADGLCDEFLYGGCGGNQNNFNSEEECQDRCFDQHPTCSLPPTAGRCTER
LIRWYYDERNKRCYEFEFTGCRGNRNNFVTERECLLWCGNESPQQPEPSAPESYSVCDLP
VEAGDCENGTVAWFYNSDSMACTAFTYSGCGGNGNRFESKEQCDRQCGEFKGVDVCNEPV
DAGPCYQWEARYYYNKATRTCERFSFGGCEGTGNRFTQRSECESVCILGQEPKTLAPKDI
CKLPAQIGRCNDTRAQERRFFYDDERGNCMPFIYSGCAGNQNNFRSYEACYDYCATTESP
VAAPKETEVLPNECETYENECRAQRCPFGIRRVPVDNSDCTRCICENPCENYECAEGQQC
AVDVSNDASRQFAPVCRETNKPGECPSLSQPEGENCGRECYTDADCREDNKCCSNGCGFV
CVRPTQPTLRPRPPVTAAPPVIYPGESPVVLEPKKPQEVDVQAAVGGIAVLRCFATGSPP
PNVTWSRSNVLIDTNQGRYVLTAAGDLTIVQVRQTDSGSYVCVASNGLGDPVSREVQLAV
TAPQEIPAYVYGEKNATQLVSLNRPAQVRCPAGGYPAPHVSWWRDRKRLGLISDRFELTR
DYSLMFRSIQLTDLGPYTCEVWNGLGRPTSMKVILKAVGPARAVTNAESPYLQYIIDPAR
APVTRRPTYPYRPQRPPQPPPPVYVEPPRRQPFVNAQAVLTLDARNTYTPGASIAMKCAV
QGVPVPSVIWTKDSIPLLANERIQITSEPHTLVIHNTTSEDTGMYGCTARNSASHSTSEE
RVTIESTIPIHPDCIDNPYFANCKLIVSGHYCRHQYYAKFCCRSCTLAGQIAFSHPNAL
Download sequence
Identical sequences A0A034V1L8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]