SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A034V3R0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A034V3R0
Domain Number 1 Region: 2080-2138
Classification Level Classification E-value
Superfamily BPTI-like 1.16e-18
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0017
Further Details:      
 
Domain Number 2 Region: 2156-2214
Classification Level Classification E-value
Superfamily BPTI-like 1.29e-18
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0021
Further Details:      
 
Domain Number 3 Region: 2714-2799
Classification Level Classification E-value
Superfamily Immunoglobulin 3.09e-18
Family I set domains 0.015
Further Details:      
 
Domain Number 4 Region: 2000-2055
Classification Level Classification E-value
Superfamily BPTI-like 5.25e-18
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0022
Further Details:      
 
Domain Number 5 Region: 2961-3039
Classification Level Classification E-value
Superfamily Immunoglobulin 2.39e-17
Family I set domains 0.014
Further Details:      
 
Domain Number 6 Region: 1941-1997
Classification Level Classification E-value
Superfamily BPTI-like 6.81e-17
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0023
Further Details:      
 
Domain Number 7 Region: 1763-1818
Classification Level Classification E-value
Superfamily BPTI-like 7.52e-17
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0018
Further Details:      
 
Domain Number 8 Region: 1882-1937
Classification Level Classification E-value
Superfamily BPTI-like 4.26e-16
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.002
Further Details:      
 
Domain Number 9 Region: 2240-2298
Classification Level Classification E-value
Superfamily BPTI-like 5.68e-16
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0044
Further Details:      
 
Domain Number 10 Region: 2368-2422
Classification Level Classification E-value
Superfamily BPTI-like 5.82e-16
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0078
Further Details:      
 
Domain Number 11 Region: 2811-2889
Classification Level Classification E-value
Superfamily Immunoglobulin 5.89e-16
Family I set domains 0.037
Further Details:      
 
Domain Number 12 Region: 2428-2481
Classification Level Classification E-value
Superfamily BPTI-like 0.00000000000000156
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0035
Further Details:      
 
Domain Number 13 Region: 1822-1877
Classification Level Classification E-value
Superfamily BPTI-like 0.0000000000000017
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0041
Further Details:      
 
Domain Number 14 Region: 2299-2353
Classification Level Classification E-value
Superfamily BPTI-like 0.0000000000000017
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0074
Further Details:      
 
Domain Number 15 Region: 2491-2550
Classification Level Classification E-value
Superfamily BPTI-like 0.00000000000000298
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0024
Further Details:      
 
Domain Number 16 Region: 341-396
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000484
Family TSP-1 type 1 repeat 0.0024
Further Details:      
 
Domain Number 17 Region: 460-520
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000575
Family TSP-1 type 1 repeat 0.0062
Further Details:      
 
Domain Number 18 Region: 638-692
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000392
Family TSP-1 type 1 repeat 0.0028
Further Details:      
 
Domain Number 19 Region: 2630-2678
Classification Level Classification E-value
Superfamily Elafin-like 0.0000000536
Family Elafin-like 0.0015
Further Details:      
 
Domain Number 20 Region: 59-110
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000798
Family TSP-1 type 1 repeat 0.0017
Further Details:      
 
Domain Number 21 Region: 579-632
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000196
Family TSP-1 type 1 repeat 0.004
Further Details:      
 
Domain Number 22 Region: 400-457
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000115
Family TSP-1 type 1 repeat 0.0045
Further Details:      
 
Domain Number 23 Region: 524-576
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000589
Family TSP-1 type 1 repeat 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A034V3R0
Sequence length 3093
Comment (tr|A0A034V3R0|A0A034V3R0_BACDO) Papilin {ECO:0000313|EMBL:JAC36405.1} OX=27457 OS=Bactrocera dorsalis (Oriental fruit fly) (Dacus dorsalis). GN=PPN OC=Tephritoidea; Tephritidae; Bactrocera; Bactrocera.
Sequence
MDLSRRLRSTALILFIVLYCVQSSYSRFYGTRHKRQYGANMYLPASYIVPGGEGDDAAEW
TEWSSPSECSRTCGGGVSFQTRECRRLARNGAPICKGGNRKYFSCNTQDCPDDEPDFRLQ
QCARFNRVPFDGVTYDWVPYTNAPNPCELNCMPVGERFYYRQKAKVIDGTRCNDRDLDVC
VDGVCQPVGCDMMLGSNAKEDKCRKCGGDGSTCRTISDTLTANNYPVGYNDIILIPSGAT
NIRVQETAPSSNYLACRNSTGHYYLNGNFRIDFPRPMFYAGCWWIYQRKPTGFAAPDQLT
CSGPTTESITIMMLVQDKNLSLTYEYSIPEELSKSTPVEYSWTHSEFEPCSAPCGGGTQT
RNVTCTNRMTLEEVDPNLCDASAKLPEEQACNEQPCAPSWVEGEWGKCSKGCGADGVQNR
TVTCERISPNGTHTTEEDSVCLENVGNKPATEQECNRDVKNCPKYHLGPWAPCDKLCGEG
KQKRKVTCYIEENGRKRVLPEEDCVEEKPPTEKECILTPCEGVDWILSEWSGCEECGQKT
ETRTAVCASKSGKIYPEEFCAPEVPALSRPCKSSKCTPKWFTSEWSKCSAACGKGVQSRI
VICGEFDGKSIKPAEESKCDASAKPESEQECEGEEKECPGQWFTGPWDPCSKPCGGGERT
REVFCLSNGTKSLNCDESKIESLSEKCNTQACTKDELIPVDSTASPLTEDAEEDDCEEDD
EDDLVSKEDLKLAEGFELDKETTAPVSLLTDELMFSDSPYTEESSDIASTDIPLTTVEGS
GEGTDITEDTSLVSEGSGDEFSSTVGASDSTESVGSTTSSISTDSSVSTESSISTDSTKS
SVEASDSTTISASSSETTGTSESSVSTESSKSPDTTDSTVASSSSETTGTSESSVSTEST
ESSDTTDSSDTTDVSESSVSTESSVSPDTTQSSESVSTDSSLSTETTEILGSSGSTDSSE
TTETPESTESSASPESTQSTASEGTDQTSSIQSSASTVSGSTEPTESTVSAETTETAGST
ESTVSSSSDSTQSTESTESTSTDTTESTSTDTTESTVSSSTDSTESTTEVSTESSISTES
ISTDSTESTESSSEFSTLSTDSTQSSVSVDTTGSPLSTESTGSSSDITGTTADVSSDSTV
TQSTVSTETSVSTESETGSPVSIDSTTGSSDSTDTTSAATSDVTTESSETSISSEATTSS
DSSDTTEISESSTDVSSTTDSGISETTADSSGSTESETTEVSGSTDISESTASGSTEEST
TGGSTESTTEGVSVESTSDISTTEGSSSSTEAGESTQSSDTTEGVSTGSAETTESGPTES
TQTTESGATDSAFESSTVDIWSTTDEDEESTPNTLEALITKAPKQKKCKAKKDCKKSTYG
CCPDKKTPAKGSFDKGCAIVKTCAETKYGCCSDGVSPAEGENNEGCPQSQCAETLFGCCP
DNFTPAEGEDAEGCPETTTAPPTTTVELVTEGSGETTDTPESTISTETPETTETPESTET
PESTETPESTEIPESTTESKVVKSCSFSEFGCCPDGTTEAKGKDFEGCESAAPTASNCRD
TEYGCCPDGLTAATGSDYAGCAPCTREPYGCCPDNQTPAHGPLGEGCCLNTVYGCCPDNI
NAARGPNFEDCDCKYTPYGCCDDQKTASRGPNKEGCGCENSTHGCCPDKITPANGPKFEG
CACHTLQFGCCPDGITIAQGPHHYGCHCSQTEFKCCPDEKTPAKGPDGEGCTCLESKYGC
CPDGIAAAEGDKFEGCASVKEPPQKACGLPKATGPCGNFSIKYFFDTSYGACARFWYGGC
EGNDNRFETESDCKSTCQEYTGKEACFLPKSSGPCTGYNKKWYFDTDRNRCEEFNYGGCY
GTSNRFDSLAECQALCAVDDTTPPCDQPMEAGPCEGNFERWFYDNQTDVCRPFNYGGCKG
NKNNYPTEHACNYHCRQPGVHKDYCSLPKQTGDCSEQHARWHYSDVDKRCMPFYYTGCGG
NKNNFPTQESCEDHCPKEVVKDVCEIPAEVGACTDYTSMWYYDTKEERCRQFYYGGCGGN
DNKFATEEACLQRCEKKPEPEPEPPREPEPEPAPAPAPAPSSREACQLDRDPGDCRSYVS
QWFFDRETQQCRNFYYGGCGGNANRFNTLEECNQLCGEGPPAPAPAPAPVGPPAASTDIC
DMPADQGDCDTYAIKWTYDNTEGRCKEFFYGGCGGNENRFETEAACTDRCLSPVNNIAVR
FGADEEAPVVAPAPAPDSAEDNTCTLPAYYGSCADNNQTRWYYNYADGLCDEFLYGGCGG
NQNNFNSEEECQDRCFDQHPTCSLPPTAGRCTERLIRWYYDERNKRCYEFEFTGCRGNRN
NFVTERECLLWCGNESPQQPEPSAPESYSVCDLPVEAGDCENGTVAWFYNSDSMACTAFT
YSGCGGNGNRFESKEQCDRQCGEFKGVDVCNEPVDAGPCYQWEARYYYNKATRTCERFSF
GGCEGTGNRFTQRSECESVCILGQEPKTLAPKDICKLPAQIGRCNDTRAQERRFFYDDER
GNCMPFIYSGCAGNQNNFRSYEACYDYCATTESPVAAPKETEVLPNECETYENECRAQRC
PFGIRRVPVDNSDCTRCICENPCENYECAEGQQCAVDVSNDASRQFAPVCRETNKPGECP
SLSQPEGENCGRECYTDADCREDNKCCSNGCGFVCVRPTQPTLRPRPPVTAAPPVIYPGE
SPVVLEPKKPQEVDVQAAVGGIAVLRCFATGSPPPNVTWSRSNVLIDTNQGRYVLTAAGD
LTIVQVRQTDSGSYVCVASNGLGDPVSREVQLAVTAPQEIPAYVYGEKNATQLVSLNRPA
QVRCPAGGYPAPHVSWWRDRKRLGLISDRFELTRDYSLMFRSIQLTDLGPYTCEVWNGLG
RPTSMKVILKAVGPARAVTNAESPYLQYIIDPARAPVTRRPTYPYRPQRPPQPPPPVYVE
PPRRQPFVNAQAVLTLDARNTYTPGASIAMKCAVQGVPVPSVIWTKDSIPLLANERIQIT
SEPHTLVIHNTTSEDTGMYGCTARNSASHSTSEERVTIESTIPIHPDCIDNPYFANCKLI
VSGHYCRHQYYAKFCCRSCTLAGQIAFSHPNAL
Download sequence
Identical sequences A0A034V3R0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]