SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A034V6G8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A034V6G8
Domain Number 1 Region: 161-242
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.38e-19
Family Synaptotagmin-like (S variant) 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A034V6G8
Sequence length 242
Comment (tr|A0A034V6G8|A0A034V6G8_BACDO) BAI1-associated protein 3 {ECO:0000313|EMBL:JAC38114.1} OX=27457 OS=Bactrocera dorsalis (Oriental fruit fly) (Dacus dorsalis). GN=BAIP3 OC=Tephritoidea; Tephritidae; Bactrocera; Bactrocera.
Sequence
MDEERMWKSMLAKLQELKVNPPTEHESRLQETDGGFFEKFGSLLKQKSHLEETEIKTNLE
PFAVDYEADNEKEVIQKECIKNSSSIGPEESVNIPELKNCKEELVESAIGMNIDDLYQEI
LFEICNNCGCESYDICPDILLEFAQEVFKISNTKHEEILRMARQKEPPKLRLNVEIIKAE
NLLPKDANGFSDPFATIYLESNASHRYNTSVKHTTLNPIWEEHFSLPIIDNPKEEVLVVE
IW
Download sequence
Identical sequences A0A034V6G8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]