SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A034VBW7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A034VBW7
Domain Number 1 Region: 729-788
Classification Level Classification E-value
Superfamily BPTI-like 0.000000000227
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0095
Further Details:      
 
Domain Number 2 Region: 410-465
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000497
Family TSP-1 type 1 repeat 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A034VBW7
Sequence length 819
Comment (tr|A0A034VBW7|A0A034VBW7_BACDO) Spondin-1 {ECO:0000313|EMBL:JAC39053.1} OX=27457 OS=Bactrocera dorsalis (Oriental fruit fly) (Dacus dorsalis). GN=SPON1 OC=Tephritoidea; Tephritidae; Bactrocera; Bactrocera.
Sequence
MLWLQAIYVLLLIAVRQSVAIICSRYPTNTNTNKSPVDENFLVTISGNPQTYILGQTYNV
TIQAYSGLRFISFKLALESQDGNPGYTQDLGHFELIDPVETRYSPNCINMVESTNTNPKT
RIDVMWVAPDKPGSGCILIRTTLLQHRDVWYMDDGGLTRAICEESTDEVESAPLSENQNK
CCACDEARYELTFKGTWSRNHHPKDFPTKGWITRFSDIIGSSHAEDYRFWEYGQLASQGM
KEFAEHGAAQTLEREFSYNFKKGKIRTIIKARGPAFPNLNGQSVASIRADPQHHLLSLAS
KIDPSPDWIVGVSGLELCMSNCTWLEQKTVTLYPWDVGTDAGPSYTSPDQPQIPPAVIQR
MRSDLPNDPRSPFFDENGGKMKPLAILEIKRQRLYERLCEDEDSNNVDVPRECFTHPWTA
WTECTSKCGEGRQFRTRVYKQPDLAKIFKCDVEIRQDRSCVGEECGRAERRLNRMRERDR
YGEYDFERVDKEEELDEGNDETKGEAEEEENEGDTEVEAENEDDQENEKTAENENEVEEA
QEKPARPGFSHRQQSRGRNRYGYMRPINAEEQESENKDENEEGEEAQEEEDETEGEKDAD
AEDEDEDANKQTNTYVNRYGYRYNVGARRKGASNEFRTVDEVEPNEDENTDDRTPTRFGN
SNRYSGGGNRRNQEIDEEDDEYEDEDEEEQKQVVEDYFGRPKWRVSNRRPNVRGNPVNDE
EPDNKQAKIPYYCLQSIKVHYCEQKVALKNYWFYSYCEDMCMLFTADKCDRNRNKFTTLE
ACEETCRPPGSQFLLRRKQKQSCVKPNALKQNSRYLGIT
Download sequence
Identical sequences A0A034VBW7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]