SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A034VDV2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A034VDV2
Domain Number 1 Region: 118-180
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000288
Family TSP-1 type 1 repeat 0.0044
Further Details:      
 
Domain Number 2 Region: 175-239
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000366
Family TSP-1 type 1 repeat 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A034VDV2
Sequence length 260
Comment (tr|A0A034VDV2|A0A034VDV2_BACDO) A disintegrin and metalloproteinase with thrombospondin motifs 12 {ECO:0000313|EMBL:JAC40674.1} OX=27457 OS=Bactrocera dorsalis (Oriental fruit fly) (Dacus dorsalis). GN=ATS12 OC=Tephritoidea; Tephritidae; Bactrocera; Bactrocera.
Sequence
VFEENVNVTDGYVEIVTIPSKARHIIIREISNSKIFLGLSMANSSNFYLNGDGLISMPGE
FRIAGTESLYDRVDEQEIIKIPQPIENAITVHAIIRGDGLNTSIRYEFALPALNNSQGVR
YSWKLGDWTDCTSSCGGGVQYRIAQCYADGEWIPSSEYCWTFAENKRPTRRIRVCNRHQC
PAHWWTGPWQYCPVTCKWSEDLSPVRHRTVVCLDQNEVVVEDDRCNIALKPPSTEPCSHN
LPKCKVSNNMENVVLQMQNI
Download sequence
Identical sequences A0A034VDV2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]