SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A034VE34 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A034VE34
Domain Number 1 Region: 128-248
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 3.67e-33
Family cAMP-binding domain 0.0000177
Further Details:      
 
Domain Number 2 Region: 252-375
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.83e-31
Family cAMP-binding domain 0.0000702
Further Details:      
 
Domain Number 3 Region: 30-73
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.000000000549
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A034VE34
Sequence length 399
Comment (tr|A0A034VE34|A0A034VE34_BACDO) cAMP-dependent protein kinase type II regulatory subunit {ECO:0000313|EMBL:JAC40045.1} OX=27457 OS=Bactrocera dorsalis (Oriental fruit fly) (Dacus dorsalis). GN=KAPR2 OC=Tephritoidea; Tephritidae; Bactrocera; Bactrocera.
Sequence
MSEGSECSDEQPPKAQASKTAAENMSTDSKQRIQVPEALREVLLEFSIAYLLEQPGDVVD
YAVQYFNKLQSNRQAAANFYRPDSPESSIISQEEEPVRRFTTRRKSVFAEAYDPENDADD
DEAERKVYPKSDEQRARLTDSVKNVLLFRSLDDEQMNQVLDAMFEKRVQPDEFIIRQGDD
GDNFYVIESGVYKVICNGDHIFTYDNTGIFGELALLYNVPRAASIQAVTEGLLWAMDRQT
FRRILLKSAFKKRKMYETLLDSVPMLKALKSYERMNLADALVSKHFSSNERIIKQGDVAD
GMYFIEDGNVSVKMDQDGKEIEISRLGKGQYFGELALVTHRPRAASVYADGDVKVAFLEV
RAFERLLGPCMEIMKRNIDDYETQLIKIFGTKNNISDTR
Download sequence
Identical sequences A0A034VE34
XP_011209763.1.45957

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]