SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A034VEN2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A034VEN2
Domain Number 1 Region: 706-767
Classification Level Classification E-value
Superfamily BPTI-like 0.000000000044
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.018
Further Details:      
 
Domain Number 2 Region: 396-452
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000262
Family TSP-1 type 1 repeat 0.0021
Further Details:      
 
Domain Number 3 Region: 466-521
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000288
Family TSP-1 type 1 repeat 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A034VEN2
Sequence length 827
Comment (tr|A0A034VEN2|A0A034VEN2_BACDO) Spondin-1 {ECO:0000313|EMBL:JAC41746.1} OX=27457 OS=Bactrocera dorsalis (Oriental fruit fly) (Dacus dorsalis). GN=SPON1 OC=Tephritoidea; Tephritidae; Bactrocera; Bactrocera.
Sequence
MVTWLHLLLVLVIIRDSWQICDRRPQGATGERSAVDENFQVLIQGNPKTFIPGQTYNISL
SVDVALKFLSFTLVVESEDDNIRPTPDTVGYFEIIDKAETRFSTLCENMIESTNANTKVR
VSVGWVAPNGGCVLIKAAVLQHRSVWYMDDGFLTKRICAEEIDEVNSQTPALDVCCACDE
AKYELIVERKWGRNTHPHDFPAESWRTRFSELIGASHTPDYRFWQYGELASRGLQEMAEH
GATRLLEMEIKSGDIRTIIKAPGIIYRQNTVSTTLANVRVDRQHHVISLVSKIEPSPDWI
LGVAGLELCLENCTWVNEKVLNLYPWDIGTDAGPSYMSPDQPQKPPDVVRRITSTSPNDQ
RSPFYEETGKPMKALATLYVRRKKLYERECDSGIVMPLECATHPWSAWSECTTRCGRGKQ
YRTRAYKDPDLAASFSCQAEMEQEQNCIGEQCRAANVEPDDGEAAGCELTPWTAWSLCSR
RCGSGYMTRSREYVNPYEREQCLNDNPLELEQRRDCEGRDCGARRTQQDRDEERNENDND
NVAVEDVERGEENDDNKEEEEEENVEGDINRLPQPELFGRRRPELSNRRTNSYYNGRQTD
WGDNDDSDRAAEGEEVDNMQFENKFEQEGEDNDNGNAYNRPYGNRGGFVRGRERNRYSGS
ATGYNSYDRNNVDDEDNNSNLREVYDEDGHKAILVGASDPNNYDVLQRFCFEKPSARMTR
CDRLNLGFRNYWFYDADERQCQIFTADGCDENKNKFRTLTACEGTCLLPHSLYLSQPGRD
EDDDNGWSRQFGESESLVKKPKKKSGRKNRKRKQKYYVGNIKNYSYK
Download sequence
Identical sequences A0A034VEN2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]