SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A034VFX3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A034VFX3
Domain Number 1 Region: 244-453
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 6.07e-54
Family Reprolysin-like 0.00078
Further Details:      
 
Domain Number 2 Region: 543-600
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000157
Family TSP-1 type 1 repeat 0.00022
Further Details:      
 
Domain Number 3 Region: 826-888
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000209
Family TSP-1 type 1 repeat 0.0044
Further Details:      
 
Domain Number 4 Region: 883-947
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000262
Family TSP-1 type 1 repeat 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A034VFX3
Sequence length 968
Comment (tr|A0A034VFX3|A0A034VFX3_BACDO) A disintegrin and metalloproteinase with thrombospondin motifs 12 {ECO:0000313|EMBL:JAC40665.1} OX=27457 OS=Bactrocera dorsalis (Oriental fruit fly) (Dacus dorsalis). GN=ATS12 OC=Tephritoidea; Tephritidae; Bactrocera; Bactrocera.
Sequence
MELFIYIVPSILQLLCIYGAAGTDLLYGLHSDKLKSGAIVIPKRVNANGDFLTFDLAYRH
DQNYRHEHSRRRRNIAKTLSKIHYQLDMDNGTMHLDLEPHTYFLAPSLIIERHRRDIRTR
KAAVPSTDCHFHGKVRGHHDSNVAISTCEGLVKIQGGRKLRHKYSFRSYRRHQHSMQCIQ
GRYPGKFNQTPQIKFKYETASDHINTINHSDSTIQSQTTDYEKINIDKNIINTKEMKRTK
RSISSPRHVEALIVADATMVAFHSKLETYILTIMNMVSALYKDPSIGNSIEIVVVKIILF
EEHEAHPDLNLTQNAQKNLDKFCRWQHKLNTANENDPYHHDVAILITRTNICGNNCMTLG
LANVGGMCKPKQSCSVNEDNGIMLSHTIAHELGHNFGMFHDTAKTGCHPRVGSIVHIMTP
TFGADTLQVSWSNCSRKYITQFLDQGFGDCLDDAPTPKRKYVYPALPPGVLFDVETQCRL
QFNLTEADVNASSCTSMDEICSTLWCRVNGECITNLRPTAPGTSCGDGKGCHNGKCIPNE
QAHPINGSWGAWSKWSDCSRTCGGGVSTQKRECNNPVPANGGLFCIGERKRYKICNHQPC
PVGEVSFRAHQCSNYDNVYYQGSIYKWLPFFDNKNPCKLLCTDVDDTIIANWGDTVKDGT
PCGVGTNDMCIDGICKKVGCDWVLDSNMREDQCGVCGGKSDRCKLIKEVFEENVNVTDGY
VEIVTIPSKARHIIIREISNSKIFLGLSMANSSNFYLNGDGLISMPGEFRIAGTESLYDR
VDEQEIIKIPQPIENAITVHAIIRGDGLNTSIRYEFALPALNNSQGVRYSWKLGDWTDCT
SSCGGGVQYRIAQCYADGEWIPSSEYCWTFAENKRPTRRIRVCNRHQCPAHWWTGPWQYC
PVTCKWSEDLSPVRHRTVVCLDQNEVVVEDDRCNIALKPPSTEPCSHNLPKCKVSNNMEN
VVLQMQNI
Download sequence
Identical sequences A0A034VFX3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]