SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A034VJM8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A034VJM8
Domain Number 1 Region: 124-248
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.15e-21
Family Regulator of G-protein signaling, RGS 0.0023
Further Details:      
 
Domain Number 2 Region: 419-499
Classification Level Classification E-value
Superfamily PX domain 0.0000000111
Family PX domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A034VJM8
Sequence length 800
Comment (tr|A0A034VJM8|A0A034VJM8_BACDO) Sorting nexin-25 {ECO:0000313|EMBL:JAC43511.1} OX=27457 OS=Bactrocera dorsalis (Oriental fruit fly) (Dacus dorsalis). GN=SNX25 OC=Tephritoidea; Tephritidae; Bactrocera; Bactrocera.
Sequence
MLTSPDYINQKIVQNIETRLAAAAISKRSYEYAASFEDFLKIINNAGNLEELSLIRKSIV
NDLMHATTIQNLQRAKGLDPDTDDHSLSKSEMNAAVRLKRYVQQLTFAKAQCEKNLSKYG
WNGNYTSDVDLSLIEVLSTAVGRRYLTLFLEPLKASALVGFYLAVEELKHSHKSAWHQLG
TEIFYTYIRVPKPEIQIDKHERKLIETFLLGDTGPDIFYDIQKNILKSLEEKYYASFVLS
EQYRQLREALNSDDFKDPTLLLRTINGSDAVADESNTALEGADGANTTLDVAAHTSYARR
KLEQLQERIDKKSQALDALKCSVKPESKVLQILEKEMEWLKNEKRQTETHLKRTDAWTEH
LGKWKATLQSVEISDEKESLQFMILVHVDEDINMPRSAENSSSSGKAGGLYARPGAISSG
WVVMRSLNQVHELQRKLRHVNSNIKSLDLPTNFKFFFLKNDRHALEKAKGQIQKFLNFIL
EDDHLNGSEAIYSFLSPSSEHLKQTLPSPKKSKFSLSTLFKSDAAKAGELSKANDPFWGL
HRDDEDISTYLEGDPSVDTKLLADLDSKDSIAEPLYALLGEIFDMGGVFKWLRKSLISFV
QITYGRTINRQIRESVAYLFEESMLHYYFSAILKSFWPGGVLASSYPVRSDDIKEMTRNA
AKDLLMDHIPEVLCNLVGAQTAKHGVLKVFEAMQNPTYNKQLFYELLEILMIEFFPEIRQ
LKLPGAKSAAHHNTTASVGSTNYSHAATTLITSTTTTAAAAAAAGSGGSSNNNQLHTTYQ
QPYEKPQPLQFQQHHFANGK
Download sequence
Identical sequences A0A034VJM8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]