SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A034VWH3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A034VWH3
Domain Number 1 Region: 71-210
Classification Level Classification E-value
Superfamily EF-hand 8.14e-28
Family Calmodulin-like 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A034VWH3
Sequence length 222
Comment (tr|A0A034VWH3|A0A034VWH3_BACDO) Myosin regulatory light chain 2 {ECO:0000313|EMBL:JAC46457.1} OX=27457 OS=Bactrocera dorsalis (Oriental fruit fly) (Dacus dorsalis). GN=MLR OC=Tephritoidea; Tephritidae; Bactrocera; Bactrocera.
Sequence
MADEKKKVKKKKTKEEGGTSETASEAASEAATPAPAATPAPASTTGSKRASGGSRGSKKS
KRAGSSVFSVFSQKQIAEFKEAFQLMDADKDGIIGKNDLRAAFDSVGKIAADKELDQMLG
EASGPINFTQLLTLFANRMASSGANDEDDVVIAAFKTFDVDGLIDGDKFRETLMNFGDKF
SAKECDDAWDQMVIDDKNQIDTAALIEMLTGKGEEEEEEAAA
Download sequence
Identical sequences A0A034VWH3
XP_011211550.1.45957

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]