SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A034WKV2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A034WKV2
Domain Number 1 Region: 46-258
Classification Level Classification E-value
Superfamily EF-hand 5.39e-30
Family Calmodulin-like 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A034WKV2
Sequence length 269
Comment (tr|A0A034WKV2|A0A034WKV2_BACDO) EF-hand calcium-binding domain-containing protein 1 {ECO:0000313|EMBL:JAC55002.1} OX=27457 OS=Bactrocera dorsalis (Oriental fruit fly) (Dacus dorsalis). GN=EFCB1 OC=Tephritoidea; Tephritidae; Bactrocera; Bactrocera.
Sequence
KEKPALLTSKCILRTITAFLASNKRNSYNAQMRAKQTNRRRRQRKMDELSGKINPKLLEN
LRKKTKFTKDEVDALCRIYRKLISNCQYSAKTLATGSSTAAIAKPHATAEGIDRIVFREL
LHSTFDIVTEEILMERIFCCWDRAHEGMPLRLEGWLTGLSIFLRGSLAERANFCFRVYDL
NSDGFITKDEMFTLLRNCLIKQPQDEDPDEGVKDLVEIVLKKFDLDKDGKVSIEDFMGTL
EAEPLLLQAFGQCLPSETATVSFFSTLQI
Download sequence
Identical sequences A0A034WKV2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]