SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A034WL32 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A034WL32
Domain Number 1 Region: 657-806
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.4e-20
Family Laminin G-like module 0.025
Further Details:      
 
Domain Number 2 Region: 295-331
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000353
Family TSP-1 type 1 repeat 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A034WL32
Sequence length 833
Comment (tr|A0A034WL32|A0A034WL32_BACDO) Collagen alpha-3(V) chain {ECO:0000313|EMBL:JAC56256.1} OX=27457 OS=Bactrocera dorsalis (Oriental fruit fly) (Dacus dorsalis). GN=CO5A3 OC=Tephritoidea; Tephritidae; Bactrocera; Bactrocera.
Sequence
MCINTQSWPAVVAYVLLCSSLLVSSIHSTPISVKGGLDSAPCVHDSISELIKKSPVILKA
LGAHIFTDDATTNELLNAAKLGATADGGSTVNGEVKKQNLQNNLFASATFHTTVGSPTAV
AATTQQQPSDISITGATATTEAATAADWARKLDGAILITLTPETIYKGASLLKMTPGAEN
AARGGSGGGGNNGRGDGSGIGRSSYGPGCGSSATAESAYQYEGQLNATLKPLSCFDGNLL
KSLPTELIVFGKLRTAQQQQQLPSEFNTAPQTDFLSISINGLHRWSPQFENHIWKHLGWD
DWSDFTLCSVTCGKGVQQRFRRCLLDNPMVNFNMHLNLNAAADAEVDDDEVAVDGLSSAG
VENTESLDNTLGGFNSAEFDTAAMMDTNGSDNLQLRKRKTTLKVSAEFETTPEVATVAEI
VTSKVQSDHDINAVPEANLLKRLTIRATTPAVPYDGRTSTTNKIDRVDYSRGKNKDNIEV
LVQQFETNLRVNEGSFLNNNHLKVNDKFANKLTKDEVNKKTAIEMQPKNKTERQNKRRRP
MKNYSTMFCEGYNIEQRNCNTFDCSDDINDLLKFYKKVPMPEDTASPATVSLQSPAGTVD
GQTTSTATAVDSASVTVNLLGNAATTGATSATNNGDASDIKASGSGATNANAVGSTLTIG
NSAPSTTPANMGYIRSWRNPLNFTIMLTLRVRNDSKAAMTIFSIRNATHNMYLESCKDGL
RLYLERDGTTEMLPVKFNLYDFRWHQVAISIQNGDFISIYADCSWTNSFVVSKRLYTLPL
DADVEIGRGFNGELQQLLVLPDNQERHQCSNKRTSINEVKRYIIDTFIDDYGN
Download sequence
Identical sequences A0A034WL32
XP_011208154.1.45957

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]