SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A034WQ16 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A034WQ16
Domain Number 1 Region: 57-178
Classification Level Classification E-value
Superfamily C-type lectin-like 3.67e-26
Family C-type lectin domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A034WQ16
Sequence length 191
Comment (tr|A0A034WQ16|A0A034WQ16_BACDO) Lithostathine-2 {ECO:0000313|EMBL:JAC56280.1} OX=27457 OS=Bactrocera dorsalis (Oriental fruit fly) (Dacus dorsalis). GN=LIT2 OC=Tephritoidea; Tephritidae; Bactrocera; Bactrocera.
Sequence
MLKHVLVIFFLCFVTQNLVADNGLQGSNEDLIFPNFTIQALDESNTYRAFPGLLRDKTFV
VVAYIRANWFKAHEICGYQGLSLASINTKAENDLLEEYLSNTGLASNNEEFWLSGSKLAD
NSRWVWLSIGRPVTYNRWALGKPFEVLRDRSCLSLLSNGQWSNDRCDAEKYFICETRCPL
TSYDTPIFLQK
Download sequence
Identical sequences A0A034WQ16

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]