SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A037 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A037
Domain Number 1 Region: 17-196
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 1.06e-82
Family MHC antigen-recognition domain 0.0000000769
Further Details:      
 
Domain Number 2 Region: 199-291
Classification Level Classification E-value
Superfamily Immunoglobulin 1.45e-30
Family C1 set domains (antibody constant domain-like) 0.000025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A037
Sequence length 352
Comment (tr|A0A037|A0A037_BISBI) MHC class I alpha chain {ECO:0000313|EMBL:ABJ53227.1} OX=9901 OS=Bison bison (American bison) (Bos bison). GN=Bibi-N OC=Pecora; Bovidae; Bovinae; Bison.
Sequence
LLLLSGVLVLTETLAGSHSLRYFYTGVSRPGLGEPRFIAVGYVDDTQFVRFDSDAPDPRT
EPRVRWMEQEGPEYWDRETRILKDAALTFRANLNTALGYYNQSEAGSHTLQLMYGCDVGP
DGRLLGGYEQYGYEGLDYIALNEDLRSWTAADTAAQITKRKWEAEGYAESLRNYLEGRCV
EGLRRYLENGKDTLLRADPPKAHVTHHPISEREVTLRCWALGFYPEEISLTWQRNGEDQT
QDMELVETRPSGDGTFQKWAALVVPSGEEQRYMCRVQHEGLQEPLTLRWEPPQTSFLTMG
IIVGLVLLVVAVVAGAVIWRKKRSGEKGRIYTQAASSDSAQGSDVSLTVPKV
Download sequence
Identical sequences A0A037

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]