SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A037UMC2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A037UMC2
Domain Number - Region: 58-114
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.012
Family Collagen-binding domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A037UMC2
Sequence length 254
Comment (tr|A0A037UMC2|A0A037UMC2_SPIME) Uncharacterized protein {ECO:0000313|EMBL:KAI92999.1} KW=Complete proteome; Reference proteome OX=570509 OS=Spiroplasma melliferum KC3. GN=SPM_003250 OC=Spiroplasmataceae; Spiroplasma.
Sequence
MKKIYYLLLGISPSLIPFSINIIDMMVQKNYNLENKISDSGIDDWNEKYIVIDFSVINTI
QDASFKKFDLEIEKKIKINKNGKKEIIINWKYYSDGKWSNIHKENTKWTHKVFWIGEMIN
DFFKDNQKILFKNLVQGNSFGYDISQPDAMIAQLFMIVFKLDFSTITVNYTSPNWFIAIT
SIGGFYVSIEEAPKHRKIEQTRKGRHELNLDYFSRNKNYEKYIMDKCLNFIFNSDIFSKY
NIEDLWNKNFIKFF
Download sequence
Identical sequences A0A037UMC2
WP_004028176.1.34469 WP_004028176.1.36273

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]