SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A037UUI2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A037UUI2
Domain Number 1 Region: 34-124
Classification Level Classification E-value
Superfamily ISP domain 1.57e-16
Family Rieske iron-sulfur protein (ISP) 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A037UUI2
Sequence length 141
Comment (tr|A0A037UUI2|A0A037UUI2_9RHIZ) (2Fe-2S)-binding protein {ECO:0000313|EMBL:KAI94171.1} KW=Complete proteome OX=858455 OS=Rhodomicrobium udaipurense JA643. GN=T281_12465 OC=Hyphomicrobiaceae; Rhodomicrobium.
Sequence
MTDTKETIVYAVCEANIAPGWVQPFTLAKVGADGKDEPFPILIVRDEARKFYAYVNACPH
EKKPLYEESENYVSDGRRHLHCMQHDARFEPNTGLCVEGECKFQSLESIPVAIIDGDVCI
AGVELAEDDDAGPPEIMIVSE
Download sequence
Identical sequences A0A037UUI2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]