SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A038GR27 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A038GR27
Domain Number 1 Region: 11-77
Classification Level Classification E-value
Superfamily TolA/TonB C-terminal domain 0.0000000068
Family TolA 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A038GR27
Sequence length 82
Comment (tr|A0A038GR27|A0A038GR27_9BURK) Uncharacterized protein {ECO:0000313|EMBL:KAK44737.1} KW=Complete proteome OX=1458357 OS=Caballeronia jiangsuensis. GN=BG58_23360 OC=Burkholderiaceae; Caballeronia.
Sequence
MALIDKLLARSAPPGAAQKRKTIVRVLLDDAGHVQDVVLKMSCGDPAKDAHALDEVRKMR
FARGQLGSGTVRRWHELAYAVD
Download sequence
Identical sequences A0A038GR27
WP_035506320.1.68449

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]