SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A044RU04 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A044RU04
Domain Number - Region: 25-70
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.0906
Family Regulator of G-protein signaling, RGS 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A044RU04
Sequence length 147
Comment (tr|A0A044RU04|A0A044RU04_ONCVO) Uncharacterized protein {ECO:0000313|EnsemblMetazoa:OVOC12724} KW=Complete proteome; Reference proteome OX=6282 OS=Onchocerca volvulus. GN= OC=Spiruromorpha; Filarioidea; Onchocercidae; Onchocerca.
Sequence
MFHHVKIADYPLDLASHGVQPKVLKDSSLWWNGPSWMAHPLERRRQEKFGEEVQERICMA
LRLTTCTEISSATKTTIADVKRFSSSRELIRTIVFVMRFMAKVSVGKFKSLTEFTKEGRF
TYSDNEQTKKLVVRMAQSEVSHENIEK
Download sequence
Identical sequences A0A044RU04
OVOC12724

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]