SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A044RVZ5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A044RVZ5
Domain Number 1 Region: 25-83
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000981
Family ATI-like 0.00067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A044RVZ5
Sequence length 100
Comment (tr|A0A044RVZ5|A0A044RVZ5_ONCVO) Uncharacterized protein {ECO:0000313|EnsemblMetazoa:OVOC12851} KW=Complete proteome; Reference proteome OX=6282 OS=Onchocerca volvulus. GN= OC=Spiruromorpha; Filarioidea; Onchocercidae; Onchocerca.
Sequence
MNPFFIFITAFVVIFTYLDAHQHRHKCRRPEIWAYCGGCELKCGQSDFAPCALRCNRPGC
YCSPFFGLRRDRYGKCISKYQCPRKKYLNAHNILPWNHIR
Download sequence
Identical sequences A0A044RVZ5
OVOC12851

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]