SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A044RYL9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A044RYL9
Domain Number 1 Region: 768-841
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000281
Family I set domains 0.019
Further Details:      
 
Domain Number 2 Region: 465-520
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000034
Family TSP-1 type 1 repeat 0.004
Further Details:      
 
Domain Number 3 Region: 325-382
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000968
Family TSP-1 type 1 repeat 0.004
Further Details:      
 
Domain Number 4 Region: 667-726
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000379
Family TSP-1 type 1 repeat 0.005
Further Details:      
 
Domain Number 5 Region: 265-329
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000575
Family TSP-1 type 1 repeat 0.0064
Further Details:      
 
Domain Number 6 Region: 35-83
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000379
Family TSP-1 type 1 repeat 0.0012
Further Details:      
 
Domain Number 7 Region: 595-664
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000876
Family TSP-1 type 1 repeat 0.005
Further Details:      
 
Domain Number 8 Region: 539-600
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000196
Family TSP-1 type 1 repeat 0.0061
Further Details:      
 
Domain Number 9 Region: 1031-1087
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000353
Family TSP-1 type 1 repeat 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A044RYL9
Sequence length 1156
Comment (tr|A0A044RYL9|A0A044RYL9_ONCVO) Uncharacterized protein {ECO:0000313|EnsemblMetazoa:OVOC1327} KW=Complete proteome; Reference proteome OX=6282 OS=Onchocerca volvulus. GN= OC=Spiruromorpha; Filarioidea; Onchocercidae; Onchocerca.
Sequence
MLIQYRLIGILFILLFPLIQQNYCFNDDSNLEKIVHQGWAKWSEWGPCSNLCGDGISSQL
RRCLDVRCVGPNRRQRVCNMQQCNNISIHTKETRCSKLDILLNNQDNHNLLPEKWIPVKT
SHQCIVVCRSLKTGKEEELEKVADGTACFIEGYNKSVCVNGICQHVGCDGIIQSNARYDH
CGVCGGTGESCGRTIFQWKDTKQFSPCDATCGPNTYRVSVSVCQNIRNNRIVPERLCADQ
PRPRPIVEKCPHIVCPSKPSTTVSYQWLTGKWSECTVSCNGGHQTRTVDCVESLNDTNGE
FVENRKVDDQYCWQTHRPAKSRKCNRKSCPKWEKGVWSSCSVTCGKGFRIRQVECRQEGE
RIDDFACKSIDRPDDEQPCFTGITCRNELDDSRDDSSDALFDRFRFIAQAPFTTAWNDKQ
HFQRDGFASSTFDVDGDPGVGSGSFGIGGSGSNGIIGTQPRFFPGQWGQCSTTCGPGVAT
RTVECIAMQGITSNIIKLPDYECEGSPKPNVFQPCQVQPCTLNEAGNDDIPVRERSLTPT
RSFKWDYSDWTACSASCLGGKQRSTLKCVDVKRRTAVAWSFCDAKQRPVDLIRSCNNDPC
PPDWDVGEMSLCSHTCGGGVRSRKVRCIRRISKTGGAESTLILPDGQCPQPKPVNSEACG
LIDCPAMWKTSNWGQCSTTCGSGEQRREVTCEQRLANGELKQFYPPIQCRHIEKPPSVQL
CDLGMCDSLSDSIFRESDNDKILSTKSTSMQQHGGHNQKLTLNIGGSAKLFVGTSLKVKC
PVRNYAKNKIIWTKDGKKITNNAHIKVSSNGALRIFHARMEDAGVYACIANGIQGNVTLS
FKPRENKHDENGNDSRSMLNQNTIDNEVENDPIAVDQQLLKKVRQSLKDNDDIRMLERLA
DVAEPGNIKIDYAAGEWSKCSHYDCGKSGRAQVRQLKCRISYQGSIGYLDDDVCESFGVV
RPPSSRSCLPSYCPRWQTSSWSECSTSRCIRHSTSMQRREVKCAYENGTNAAFDLCDRES
RPKVKKECINVNCTAIWRASVWGQCSRTCGDGGVQMRLLRCVWRGTRKPAGRNCQSSLRP
TAIRACQDASNLPACPTKLSTDDNSIMMADDNCHDKSRFCEILKIFHSCENRDIREKCCY
TCNYYKYEVTSEVRMM
Download sequence
Identical sequences A0A044RYL9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]