SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A044S8X7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A044S8X7
Domain Number 1 Region: 667-797
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 3.4e-39
Family Regulator of G-protein signaling, RGS 0.0000261
Further Details:      
 
Domain Number 2 Region: 287-417
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.000000603
Family Synaptotagmin-like (S variant) 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A044S8X7
Sequence length 843
Comment (tr|A0A044S8X7|A0A044S8X7_ONCVO) Uncharacterized protein {ECO:0000313|EnsemblMetazoa:OVOC1993} KW=Complete proteome; Reference proteome OX=6282 OS=Onchocerca volvulus. GN= OC=Spiruromorpha; Filarioidea; Onchocercidae; Onchocerca.
Sequence
MNDPYGVFINSHSTLSLNRYNERKRGRHERRQDEILMNLSSESEDEFYDCHKDMAMESVS
DITSDSDFCQPIPVARGANRNWINKPAMMRTRRSQVPCGIGARARTRHGSLPVLMPIDHS
SSYETETTNEDDDSEFSDRRHRSPPPSLLRGLSMIEELSPINDTSDDIPKVPSLQLTRNW
HPLATSTTTSIGLPKTNPHHLKTISTSTPATSMSSIGRCRSSVLSAYNNIMYDTLERPAS
FFEGQTPRKDFGRPQSEILSSGCLSNINWKPDHFGLPTPFARRIGCKGKLELTMSISGCF
LTVSVVRAIYFLDPAIAQASSYVRIEIRPNPVYNKRIRSYSEDRFSQNDREKSFRTRLVL
LSNRPQFHENFTFELRRNHYRHHDLLSVSVWITNAGNSARKQMLGCMAFPIRRLIRKANL
MTERGFDENLQTFERTVINDGDFFLLRPELGERQNFPENKINVRKYYDDIGISSSCSIVS
HSPRKIMRNSNWNTQNPQTHHRHHRHNQTASLSPSSSGHTASLLPHQYSKSASKIPISIR
HNDLDYTIGSSSITSSTTVSENLHRELIGVPFITTTSDITSDGSSVADVKQSTGPSTNAH
YLCANDSITSVRRAASFTFSPKGHLDKVNQRSQLHGIEPKRRFSKFAKTLDFIRSKMDSC
STSTLYPSKEEIILWQDSFERLLNHKYGCMLFRTFLKGEFSDENVDFWIECEEFRKMKEG
KKSTIQKAHSIYNKYIAEQSSKEVNLDSDTRAATKAALENGAKPNMFSLAQTRIEQLMAK
DSYRRFLKSKLFLDLLTNGTSTVSNTHKTSSKDNEHEHQLKSSTVETLKTVDSTCTAGKS
KNS
Download sequence
Identical sequences A0A044S8X7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]