SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A044SGJ4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A044SGJ4
Domain Number 1 Region: 483-565
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.34e-18
Family DIX domain 0.0094
Further Details:      
 
Domain Number 2 Region: 3-137
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.77e-17
Family Regulator of G-protein signaling, RGS 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A044SGJ4
Sequence length 569
Comment (tr|A0A044SGJ4|A0A044SGJ4_ONCVO) Uncharacterized protein {ECO:0000313|EnsemblMetazoa:OVOC25} KW=Complete proteome; Reference proteome OX=6282 OS=Onchocerca volvulus. GN= OC=Spiruromorpha; Filarioidea; Onchocercidae; Onchocerca.
Sequence
MDGYKTWSNSLESILEDASALEAFKEWFKDDKTRLIDSIDLYFAIKAFKNMIERNDPKCA
EIACKIHRRFISIRSGTCAFLPDVIRKEMSERIHALSANKLPHGNLFESCQEELLAYLRK
QHVLFVHSDHFYNLLNQNAEIIEPTVVFDENDPIVSSTGCHACASTSDDISIRFGGRNSI
WKKSKPPRRNFGVQNVSKRDSRDSVSCSAVSSEDSGNKRSSSKRHSERLPLQRVHGHQQQ
QALLTCPPDGSDFKHQRPEERERFSEILRYKLDKIAYRLEQYKHETGIEIFARDLDQLTI
TTTTTEGNDEVDSVISNDSLDKYEQRMNAECDMNPPKEENRRSVSASPIRFTNTLHVENM
SNPYGRHGFAPPPGGVTYKNYRNCATNHELHSLRSTTPLSSNDYGGHRYSDSSGFCSSES
ANIINRAALFEKARHMAMSTQTTTSFPQSCSEVSTSSFNYYSFPFEQQEKRPLFVNNLYP
KKQQLVISYKEENAEAPFVAKLEMRDITFREFRRCFGISSKTTKRFFFKSDCEDCSAPYQ
WTIIDDDCAVLPVFEGRITAECRSCSESD
Download sequence
Identical sequences A0A044SGJ4
OVOC25

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]