SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A044TD37 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A044TD37
Domain Number 1 Region: 7-49
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0000000201
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0029
Further Details:      
 
Domain Number 2 Region: 154-204
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000204
Family Motor proteins 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A044TD37
Sequence length 227
Comment (tr|A0A044TD37|A0A044TD37_ONCVO) Uncharacterized protein {ECO:0000313|EnsemblMetazoa:OVOC4518} KW=Complete proteome; Reference proteome OX=6282 OS=Onchocerca volvulus. GN= OC=Spiruromorpha; Filarioidea; Onchocercidae; Onchocerca.
Sequence
MAESSNENYKVPAGLRPLLEALVRETLRIQPSDLISFSMLFFSILQKHRKENNAEDVLKD
PALYEFFKNDLWKQYHEKGNDMTERSSRPLDKAATKIQAAFRGHIVRANPEKYGLSKKET
DIVCPSMKCINSQNAGKDLKCHSINATGSAAGRDAVEDRAATRIQAEIRGFLARRHLQQI
KKEGNEAAKKIQAHIRGYLTRKHLDEVGIPHKHSTVAQLHNGLQEHV
Download sequence
Identical sequences A0A044TD37 A0A182E9W5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]