SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A044TL52 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A044TL52
Domain Number - Region: 6-76
Classification Level Classification E-value
Superfamily IpaD-like 0.0575
Family IpaD-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A044TL52
Sequence length 115
Comment (tr|A0A044TL52|A0A044TL52_ONCVO) Uncharacterized protein {ECO:0000313|EnsemblMetazoa:OVOC5044} KW=Complete proteome; Reference proteome OX=6282 OS=Onchocerca volvulus. GN= OC=Spiruromorpha; Filarioidea; Onchocercidae; Onchocerca.
Sequence
MHDVSTEMSQFYQKFINVHENISGIYKTSSANSYGKNFVTSFNFVSSFLNCFAQEFNITL
ILVCKPTVLPKKKEKKSVNSINFFFTIDFMEFFICLCCYKSQKRQENRANNSPPR
Download sequence
Identical sequences A0A044TL52
OVOC5044

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]