SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A044TXN9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A044TXN9
Domain Number 1 Region: 144-222
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0000000000306
Family Pan module (APPLE domain) 0.088
Further Details:      
 
Domain Number 2 Region: 45-134
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000000000745
Family Hairpin loop containing domain 0.014
Further Details:      
 
Domain Number 3 Region: 452-491
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000419
Family TSP-1 type 1 repeat 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A044TXN9
Sequence length 612
Comment (tr|A0A044TXN9|A0A044TXN9_ONCVO) Uncharacterized protein {ECO:0000313|EnsemblMetazoa:OVOC5777} KW=Complete proteome; Reference proteome OX=6282 OS=Onchocerca volvulus. GN= OC=Spiruromorpha; Filarioidea; Onchocercidae; Onchocerca.
Sequence
MQCLHVLNSISLVIFFSFISINAAKTTKDSENVQEGSSFPIEALCENRLTAFTVSDNTCL
VSSSSLVYEDVTEEVCLKMCSSNRDSNGRTILCASVVYDHAVFVCTVFRSKSYPEGDLKT
EVAPGKRLFEKFCLKDAPIECADSRFLKVHQSVIIGYARNVSLARSIDECIEQCLTEYFQ
CRSAMYFYTEGECITNTESAMTQPASFAREESDKVIYIQNGCPTILARQKQLEKSAARAT
AITAEPSLIADENIENVKGEAETIRSTTIISEDNSNNNKGKKEGREIPDTDDITAVNSSI
EENTLKQRNYLNDRIHNDKEKSDNSFEIDSGKFASSEEATEASTIKEMSKILERNLKRVK
TESDTANFREHLKSLKQTKLQQMKREFTPEENEENHVGKNSSLEISPSPHQVENQQTERA
NSVIVVQEGIKAQKPIKRLNIITLNKFKDENHFSEWSNWSPCRRLGEKRIRRRKCYNLQK
CVGALMEVKKCPKTIRKVEPEFKDGDGLQKANDSVPVMSVPPEKSNLPNKTDLVTGILDD
ISSQSQQPHSENESTEKTNEKIWSPWRGICQEFASGHPCKNHEIIGFESRDCLAIDNAKC
KGPFFRYCTISC
Download sequence
Identical sequences A0A044TXN9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]