SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A044U2T1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A044U2T1
Domain Number 1 Region: 41-84
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000222
Family TSP-1 type 1 repeat 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A044U2T1
Sequence length 152
Comment (tr|A0A044U2T1|A0A044U2T1_ONCVO) Uncharacterized protein {ECO:0000313|EnsemblMetazoa:OVOC6085} KW=Complete proteome; Reference proteome OX=6282 OS=Onchocerca volvulus. GN= OC=Spiruromorpha; Filarioidea; Onchocercidae; Onchocerca.
Sequence
MNLNLVPRGPSTSTSLPAKSPTVINQSRIFLLSQNDNNVSNWSEWTDWQRCFCGKQIRTR
ICHYETSFLVSGCRGKSYESRPCNERDHCPTTTPLSTKISSISTTVKAKFSRSSLHQPLS
IATAQKTNDMQINYFKDSNTNDDIDPAISDSS
Download sequence
Identical sequences A0A044U2T1
OVOC6085

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]