SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A044UNN6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A044UNN6
Domain Number 1 Region: 32-131
Classification Level Classification E-value
Superfamily Cystine-knot cytokines 5.26e-25
Family Interleukin 17F, IL-17F 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A044UNN6
Sequence length 150
Comment (tr|A0A044UNN6|A0A044UNN6_ONCVO) Uncharacterized protein {ECO:0000313|EnsemblMetazoa:OVOC7410} KW=Complete proteome; Reference proteome OX=6282 OS=Onchocerca volvulus. GN= OC=Spiruromorpha; Filarioidea; Onchocercidae; Onchocerca.
Sequence
MMTNWKLFRWFTETSESEILEIGDEDWNPPIPESSFCNTEPVTDINSTTMQRSLCPWQWK
LNHDENREPKIISEAHCLCRHSRGSSGSFCMPIKRQIAVLKRIRCNPTTGYYEYSRALQT
ITVGCHSVLPRSQKASSLTKLYRKTNIIEI
Download sequence
Identical sequences A0A044UNN6
OVOC7410

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]